Sign In | Join Free | My
Search by Category
Home > Measurement & Analysis Instruments >

Measuring & Analysing Instrument Design Services

Refine Search

Business Type


Measuring & Analysing Instrument Design Services

All Measuring & Analysing Instrument Design Services wholesalers & Measuring & Analysing Instrument Design Services manufacturers come from members. We doesn't provide Measuring & Analysing Instrument Design Services products or service, please contact them directly and verify their companies info carefully.

Total 3383 products from Measuring & Analysing Instrument Design Services Manufactures & Suppliers
 Wireless Touch Screen Pad Allwinner A83T Processor For Restaurant Ordering System Manufactures

Brand Name:SIBO

Model Number:Q896S

Place of Origin:CHINA

Android 4.4.4 Power over Ethernet, Wifi, 3G for Hotel, Restaurant Menu Service Touch screen Pad Key Features: CPU: ARM Cortex A7 Octa-Core, 1.2Ghz OS: Android 4.4.4 RAM: DDR3 2GB ROM: 8GB NAND FLASH Display: 7 Inch IPS Display, Resolution:1024 x 600, ...

Shenzhen Sibo Industrial & Development Co.,Ltd
Verified Supplier


 Wholesale China made Cow Split  Suede  Tan Color Army Desert Boots Manufactures

Brand Name:HengSen Army Boot

Model Number:Cement OR DMS Army Desert Boot

Place of Origin:China

With the most professional Army Desert Boot factory, HengSen is one of the leading China Army Desert Boot, Military Boot manufacturers. Welcome to wholesale quality Army Desert Boot from us. Police Boot Catalogue.pdf HengSen produces Strong, Light-weight ...

Tianjin HengSen Footwear (Military DMS Boot) Co.,Ltd.
Site Member


 Peptide synthesis  API powder ACTH(1-39) / Corticotropin CAS 9002-60-2 pharmaceutical intermediate Manufactures

Brand Name:Youngshe Peptide

Model Number:CAS No: 9002-60-2

Place of Origin:China

ACTH(1-39) / Corticotropin 1.Basic information: Cas No: 9002-60-2 Formula: C207H308N56O58S Molecular: 4541.0658 Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF Purity: 98% Appearance: white powder Source: synthetic Also known as: Adrenocorticotropin, ...

Chengdu youngshe chemical Co,.Ltd
Active Member

 Power Voltage Converter AC 110V-220V to DC 0-48V Module Switching Power Supply Digital Display 100W Voltage Regulator Manufactures

Brand Name:PR

Model Number:PR-A100

Place of Origin:China

Switching Power Supply _ PR-100 Series Two years warranty Built-in EMI filter 100% Load aging test Wide range of input voltage Accurate and stable output voltage Output over-voltage, over-current and short-circuit protection Low output ripple and noise ...

Power Real CO.,Limited
Site Member


 5mm silver mirror  Waterproof Silver Mirror Glass, Double Coated with Italy Fenzi Paints Manufactures

Brand Name:OBG

Model Number:customized

Place of Origin:Qingao

Silver mirror Specifications: Thickness 2 mm to 6 mm Size according to your design. Payment terms T/T 30% as deposited and balance should be send to us for as copy of Bill of loading. Min. Order: 100Pieces per Item Use: For bath mirror, decorative mirror ...

Qingdao Oriental Brother New Energy Technology Co., Ltd.
Active Member


 18K Luxury Gold Jewelry Love Necklace 18K Gold Love Ring Pendant with 2 Diamonds B7219500 Manufactures

Place of Origin:China

Brand Name:18K Gold Luxury Jewelry

Model Number:B7219500

18K Luxury Gold Jewelry Love Necklace 18K Gold Love Ring Pendant with 2 Diamonds B7219500 SETTING Metal Type: 18K gold MAIN STONE Stone Type: Natural Diamonds Weight: Approx. 0.03ct Quantity: 2pcs Cut: round Color: F-G white Clarity: VVS/slightly defects ...

Shenzhen Jsely Jewelry Co., Ltd.
Site Member


 CONTEC MS100 SpO2 Simulator Patient Oximeter Simulator with DC Power Manufactures

Place of Origin:China

Model Number:MS100

Brand Name:Contec

CONTEC MS100 SpO2 Simulator Patient Oximeter Simulator Brief Introduction MS100 SpO2 Simulator is a kind of Separated SpO2 simulator, small and light. It can perform a series of tests for the oximeter by simulation means, and gives cognizance of veracity ...

Shenzhen Huge Creation Technology Limited
Verified Supplier


 Long cycle life rechargeable lithium ion battery to storage solar energy 3.2V35Ah Manufactures

Brand Name:HJY

Model Number:HJY-LFP26136181-35


Max Discharging Rate Max Continuous Discharging:2C Max Peak Discharging:3C Cut-off Voltage Charging:3.65V Discharging:2.0V Internal Resistance ≤ 4mΩ (At 0.2C rate, 2.0V cut-off) Working Temperature Charging: 0℃~45℃ Discharging: -20℃~60℃ Storage...

Shenzhen HJY Technology Co. Ltd.
Site Member

 134.2kHz Animal Ear Tag for Pig/Cow/Sheep Manufactures

Place of Origin:GuangZhou

Brand Name:L-Link

Model Number:L-Link_AM01

the electronic ear tag is mainly used in livestock tracking and management, such as cows, dogs, pigs and other livestock. Normally it was installed onto the animals’ ear by a special animal ear tag pliers. The electronic ear tag uses non-toxic, no smell...

GuangZhou L-Link Technologies,Inc
Site Member


 Vertical Truss Tower for Moving Head Manufactures

Brand Name:7Clighting

Model Number:7C-LS007

Place of Origin:CHINA

Product Description Product name : Vertical Truss Tower for Moving Head Product No. : 7C-LS007 Item: 7C-LS007 Height Optional: 1M / 1.5M / 2M Tube: Main tubes Φ50×2mm,Single connection bar Size (Top Plate): 350 x 350 x 8mm Size (Base Plate): 600 x 600 x...

Qicai Lighting Equipment Limited
Site Member


 AC 220 V 1 ph 3 Lines Cellphone Button Life Testing Machine For Industry Manufactures

Brand Name:ASLi

Model Number:AS - 8330 C

Place of Origin:China

AS-8300C Button Life testing Machine.pdf Ce Certification Cellphone Button Life Testing Machine For Industry Used Application: Button life testing machine can do the keyboard life test of computer, cell phone, calculator and notepad. Features: 1 Can test ...

Verified Supplier

 Hardware accessories counting and packing machine, Hardware accessories pouch making machine Manufactures

Brand Name:Bestar Packaging Machine

Model Number:Hardware accessories counting and packing machine

Place of Origin:Foshan ,China

New design Bestar Automatic Hardware accessories counting and packing machine, Hardware accessories pouch making machine,hardware accessories weighting and packing machine, hardware accessories packing machine, Hardware accessories packaging machine , ...

Bestar Packing Machine Co.Ltd
Site Member


 PC Carton Compression Tester, Package ,Corrugate Box ,Carton Compression Tester Manufactures

Place of Origin:Guangdong, China (Mainland)

Brand Name:HAIDA

Model Number:HD-A502S-1500

PC Carton Compression Tester, Package ,Corrugate Box ,Carton Compression Tester Specifications Concrete Compressive Strength Tester Price 1.Motor:Import servo motor 2.Control system:Computer control Product introduce: PC Carton Compression Tester main for...

Dongguan Haida Equipment Co.,LTD
Verified Supplier


 big bag /open top jumbo bag 1500kg loading OEM Made in China Manufactures

Brand Name:Hongye

Model Number:HY-FIBC-125

Place of Origin:China

Product Name PP woven bag/ Grain bag/ Fertilizer bag/ Chemical powder bag/ Sand sack Load capacity 500kg-2000kg Denier 350 to 1200 Regular size 85*85*90 cm 90*90*100cm 95*95*110cm as customer request GSM 40 GSM TO 250 GSM Top Top full open/Filling spout/ ...

Qinhuangdao Hongye Packing Products Co., Ltd.
Active Member


 Intelligent Septic System Pump Control Panel Manufactures

Brand Name:Leading

Model Number:L922-S

Place of Origin:CHINA

Intelligent Sewage Three Phase Water Pump Controller- Auto / Manual , One Button Calibration ,With LCD Displaying Product Brief: L922-S Sewage Pump controller ,is a smart and intelligent three phase fully automatic pump controller with built-in water ...

Hunan Leading Science and Technology Development Co.,Ltd
Verified Supplier


 Button Force Testing Equipment 3 Points / 4 Points Bending Test Machine Manufactures

Brand Name:Infinity Machine

Model Number:RS-6900H

Place of Origin:China

Button Force Testing Equipment 3 Points / 4 Points Bending Test Machine Model: RS-6900H Application: This servo control Multi-function tester is controlled by X,Y,Z axes, it is suitable for the button force test, the compression for electronic products, ...

Infinity Machine International Inc.
Verified Supplier


 Spot welding tip for enamelle wire welding Manufactures

Brand Name:shouchuang

Place of Origin:China

Place of Origin: Guangdong, China (Mainland) Brand Name: shouchuang Model Number: customization Material: tungsten-molybdenum alloy Application: welding for electronic components life: 30-100k times Model: customization Payment: T/T Package: Carton ...

HeFei Zulr Trade Co.,Ltd
Active Member

 shower door knob shower door hardware WL-3004 Dia.30x32mm glass door handle Manufactures

Brand Name:WL

Model Number:WL-3004

Place of Origin:Foshan China

shower door knob shower door hardware WL-3004 Dia.30x32mm glass door handle material: 304# stainless steel or copper/brass finished: chrome / satin size: Dia.30x32mm function: shower door handle packing: by carton No.: 30pcs/box MOQ: 100/pcs 10000pcs/week...

Willing Hardware Manufacturing Company
Site Member

 Diagonal Eyepiece worked for TOPCON Manufactures

Brand Name:NO BRAND

Model Number:DFE-1TPA

Place of Origin:CHINA

Diagonal Eyepiece worked for TOPCON Specification Type Description DFE-1TPA For TOPCON instruments with external threads

Verified Supplier


 Good quality with competive price smart Pdlc film from China Manufactures

Brand Name:CONE

Model Number:C-SFF

Place of Origin:CHINA

Smart film is an intelligent film which can adjust light under electric pressure to switch between transparent and opaque. When power off, the film turns opaque and when power on the film turns transparent. Perfectly meet the double requirements of glass ...

Cone Industrial Co., Limited
Site Member


Go to Page
Inquiry Cart 0